CoraLite® Plus 488-conjugated CD133 Monoclonal antibody

CD133 Monoclonal Antibody for
Cat No. CL488-66666
Clone No.2B8A2

Host / Isotype

Mouse / IgG1

Reactivity

Human and More (1)

Applications

AC133, Antigen AC133, CD133, CORD12, MCDR2, MSTP061, PROM1, PROM1 1, PROM1 1,2,3, PROM1 1,2,3,5,7, PROM1 1,6,7, PROM1 2, PROM1 2,3,4,5, prominin 1, Prominin like protein 1, PROML1, RP41, STGD4

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-66666 targets CD133 in applications and shows reactivity with Human samples.

Tested Reactivity Human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13327

Product name: Recombinant human CD133 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 505-782 aa of BC012089

Sequence: LICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPL

Predict reactive species
Full Name prominin 1
Calculated Molecular Weight 97 kDa
Observed Molecular Weight 115 kDa, 80-90 kDa
GenBank Accession NumberBC012089
Gene Symbol CD133
Gene ID (NCBI) 8842
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO43490
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD133, also known as PROM1 (prominin-1) or AC133, belongs to the prominin family. CD133 is a transmembrane glycoprotein with an NH2-terminal extracellular domain, five transmembrane loops and a cytoplasmic tail. The expression of CD133 has been reported in hematopoietic stem cells, endothelial progenitor cells, neuronal and glial stem cells, suggesting the potential role of CD133 as a cell surface marker of adult stem cells. CD133 has also been reported as a marker of cancer stem cells in various human tumors. CD133 is a highly glycosylated protein with an apparent molecular weight of 115-120 kDa. After the treatment of the lysates with glycosidase, CD133 shifted to a protein with an apparent molecular weight of 80-90 kDa (PMID: 23150174; 20068153).

Publications

SpeciesApplicationTitle
human

Exp Cell Res

Downregulation of CTRP1 Reduces Radio-resistance in Glioblastoma Cells by Inhibiting the Expression of CD133 after X-ray and Carbon Ion Irradiation

Authors - Ke Huang
human

J Cancer

Linc00662 sponges miR-15b-5p to promote hypopharyngeal squamous cell carcinoma progression by facilitating cancer stem cell-like phenotypes

Authors - Binghuang Zhang
human

Cell Biosci

TC2N maintains stem cell-like characteristics to accelerate lung carcinogenesis by blockade of dual specificity protein phosphatase 3

Authors - Jing Gu
Loading...
||
New chat Able
正在加载,请稍候...