Anti-Mouse CD147 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of mouse thymocytes using 98229-1-RR (same clone as 98229-1-PBS)

  1x10^6 mouse thymocytes were surface stained with 0.25 ug Anti-Mouse CD147 Rabbit RecAb (98229-1-RR, Clone: 241852B4) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98229-1-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse thymocytes using 98229-1-RR (same clone as 98229-1-PBS)

  1x10^6 mouse thymocytes were surface stained with 0.25 ug Anti-Mouse CD147 Rabbit RecAb (98229-1-RR, Clone: 241852B4) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98229-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98229-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98229-1-RR against Mouse CD147 were performed. The affinity constant is below 1 pM.

CD147 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98229-1-PBS

Clone No.241852B4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

241852B4, Basic immunoglobulin superfamily, Basigin, Bsg, HT7 antigen

---

Product Information

98229-1-PBS targets CD147 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1530

  Product name: Recombinant Mouse CD147 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-325 aa of NM_009768.2

  Sequence: AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR

• Full Name: basigin
• Calculated Molecular Weight: 42 kDa
• GenBank Accession Number: NM_009768.2
• Gene Symbol: CD147
• Gene ID (NCBI): 12215
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P18572-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD147, also known as Basigin or extracellular matrix metalloproteinase inducer (EMMPRIN), is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 7812975). The molecule is composed of an intracellular portion, an extracellular portion and a single transmembrane region. CD147 is expressed on a variety of cell types (e.g., hematopoietic, epithelial, and endothelial cells) and at varying levels (PMID: 32968061). CD147 is a pleiotropic molecule that plays an important role in fetal, neuronal, lymphocyte and extracellular matrix development (PMID: 17945211).