CoraLite® Plus 647 Anti-Human CD147 Rabbit scFv Antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 647 Anti-Human CD147 Rabbit scFv Antibody (CL647-SF98558)

• Site-specific conjugation

CD147 Recombinant Antibody for FC

Cat No. CL647-SF98558

Clone No.251215H5

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC

Synonyms

5F7, Basigin, BSG, Collagenase stimulatory factor, EMMPRIN

• 

  FC experiment of human PBMCs using CL647-SF98558

  1x10^6 human PBMCs were surface stained with 0.25 ug CoraLite® Plus 647 Anti-Human CD147 Rabbit scFv Antibody (CL647-SF98558, Clone: 251215H5) or 0.25 ug CoraLite® Plus 647 Rabbit scFv Isotype Control (CL647-SF98136, Clone: 240953C9). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using CL647-SF98558

  1x10^6 human PBMCs were surface stained with 0.25 ug CoraLite® Plus 647 Anti-Human CD147 Rabbit scFv Antibody (CL647-SF98558, Clone: 251215H5) (red) or 0.25 ug CoraLite® Plus 647 Rabbit scFv Isotype Control (CL647-SF98136, Clone: 240953C9) (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-SF98558 targets CD147 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Type: Rabbit / scFv
• Class: Recombinant
• Type: Single-chain variable fragment antibody (scFv)
• Immunogen:

  CatNo: Eg0436

  Product name: Recombinant Human CD147 protein (His Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 138-323 aa of BC009040

  Sequence: EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA

• Full Name: basigin (Ok blood group)
• Calculated Molecular Weight: 385 aa, 42 kDa
• GenBank Accession Number: BC009040
• Gene Symbol: CD147
• Gene ID (NCBI): 682
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Source: Anti-Human CD147 scFv from clone 251215H5, consisting of VH-GGGGS linker-VL (N- to C-terminus), with a His tag at the C-terminus.
• Form: Liquid
• Purification Method: Affinity purification
• Storage Buffer: 50mM HEPES, 150mM NaCl, 5mM EDTA, 0.1% CHAPS, 10% Sucrose and 0.1% Proclin300, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

CD147, also known as Basigin or extracellular matrix metalloproteinase inducer (EMMPRIN), is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 7812975). The molecule is composed of an intracellular portion, an extracellular portion and a single transmembrane region. CD147 is expressed on a variety of cell types (e.g., hematopoietic, epithelial, and endothelial cells) and at varying levels (PMID: 32968061). CD147 is a pleiotropic molecule that plays an important role in fetal, neuronal, lymphocyte and extracellular matrix development (PMID: 17945211).