FcZero-rAb® PerCP-Cyanine5.5 Anti-Mouse CD147 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® PerCP-Cyanine5.5 Anti-Mouse CD147 Rabbit Recombinant Antibody (CPY5-FcA98229)

• 

  FC experiment of mouse thymocytes using CPY5-FcA98229

  1x10^6 mouse thymocytes were surface stained with 0.25 ug PerCP-Cyanine5.5 Anti-Mouse CD147 Rabbit RecAb (CPY5-FcA98229, Clone: 241852B4) or 0.25 ug PerCP-Cyanine5.5 Rabbit IgG Isotype Control RecAb (CPY5-FcA98136, Clone: 240953C9). Cells were incubated with MonoZero™ Monocytes blocking Reagent(PF00020) prior to staining. Cells were not fixed.

• 

  FC experiment of mouse thymocytes using CPY5-FcA98229

  1x10^6 mouse thymocytes were surface stained with 0.25 ug PerCP-Cyanine5.5 Anti-Mouse CD147 Rabbit RecAb (CPY5-FcA98229, Clone: 241852B4) (red) or 0.25 ug PerCP-Cyanine5.5 Rabbit IgG Isotype Control RecAb (CPY5-FcA98136, Clone: 240953C9) (blue). Cells were incubated with MonoZero™ Monocytes blocking Reagent(PF00020) prior to staining. Cells were not fixed.

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD147 FcZero-rAb^® Recombinant Antibody for FC

Cat No. CPY5-FcA98229

Clone No.241852B4

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

Basic immunoglobulin superfamily, Basigin, Bsg, HT7 antigen, Membrane glycoprotein gp42

---

Tested Applications

• Positive FC detected in: mouse thymocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CPY5-FcA98229 targets CD147 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1530

  Product name: Recombinant Mouse CD147 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-325 aa of NM_009768.2

  Sequence: AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR

• Full Name: basigin
• Calculated Molecular Weight: 42 kDa
• GenBank Accession Number: NM_009768.2
• Gene Symbol: CD147
• Gene ID (NCBI): 12215
• RRID: AB_3749241
• Conjugate: PerCP-Cyanine5.5 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 482 nm / 690nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P18572-1
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD147, also known as Basigin or extracellular matrix metalloproteinase inducer (EMMPRIN), is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 7812975). The molecule is composed of an intracellular portion, an extracellular portion and a single transmembrane region. CD147 is expressed on a variety of cell types (e.g., hematopoietic, epithelial, and endothelial cells) and at varying levels (PMID: 32968061). CD147 is a pleiotropic molecule that plays an important role in fetal, neuronal, lymphocyte and extracellular matrix development (PMID: 17945211).