CD155/PVR Recombinant monoclonal antibody, PBS Only

CD155/PVR Uni-rAb® Recombinant Antibody for IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 84138-1-PBS
Clone No.241405B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Cytometric bead array, Indirect ELISA

PVR, 241405B2, CD155, HVED, Necl 5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84138-1-PBS targets CD155/PVR in IF/ICC, Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0971

Product name: Recombinant Human CD155/PVR protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 21-343 aa of BC015542

Sequence: WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRN

Predict reactive species
Full Name poliovirus receptor
Calculated Molecular Weight 45 kDa
GenBank Accession NumberBC015542
Gene Symbol CD155/PVR
Gene ID (NCBI) 5817
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15151
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD155, also known as PVR, is a type I transmembrane glycoprotein in the immunoglobulin superfamily. It contains three extracellular immunoglobulin-like domains, D1-D3, of which D1 is recognized by the virus. Mature human CD155 consists of a 323 amino acid extracellular domain with one N-terminal V-type and two C2-type Ig-like domains, a 24 amino acid transmembrane segment, and a 50 amino acid cytoplasmic tail. CD155 is thought to play a role in adhesion by interaction with the ECM component vitronectin as well as a role in NK killing of tumor cells. CD155 binds to two receptors of NK cells, CD96 and CD226, and accumulates at cell-cell contact sites, leading to the formation of mature immune synapses between NK cells and target cells. CD155 serves as the entry receptor for poliovirus and thereby mediates human susceptibility to poliovirus infection.

Loading...
||
New chat

Able

正在加载,请稍候...