CoraLite® Plus 647 Anti-Mouse CD155/PVR Rabbit Recombinant Antibody

CD155/PVR Uni-rAb® Recombinant Antibody for FC
Cat No. CL647-98077
Clone No.240731B1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Pvr, 240731B1, CD155, poliovirus receptor, Tage4

Formulation:  PBS, Azide
PBS, Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse thymocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98077 targets CD155/PVR in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0903

Product name: Recombinant Mouse CD155/PVR protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 29-348 aa of NM_027514.2

Sequence: DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHL

Predict reactive species
Full Name poliovirus receptor
Calculated Molecular Weight45 kDa
GenBank Accession NumberNM_027514.2
Gene Symbol CD155/PVR
Gene ID (NCBI) 52118
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8K094
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD155, also known as the poliovirus receptor (PVR) or Necl-5, is one of the nectin-like family members, belonging to the Ca2+ independent immunoglobulin superfamily (IgSF) in cell adhesion molecules (PMID: 37660884). CD155 is a type I transmembrane protein composed of three extracellular immunoglobulin-like domains, a transmembrane domain, and a cytoplasmic tail. It is involved in cell-to-cell and cell-to-ECM adhesion (PMID: 32019260; 11437656). CD155 acts as a ligand for immune receptors, including TIGIT, CD96 and CD226, which are expressed on T cells and NK cells. CD155 interacts with these receptors to modulate immune responses, such as T cell activation and NK cell-mediated cytotoxicity (PMID: 37660884). CD155 serves as the entry receptor for poliovirus and thereby mediates susceptibility to poliovirus infection (PMID: 15034010).

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 CD155/PVR antibody CL647-98077Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...