CoraLite®594 Anti-Human CD16 Rabbit Recombinant Antibody

• 

  FC experiment of human peripheral blood leukocytes using CL594-98387

  1x10^6 human peripheral blood leukocytes were surface stained with 5 ul CoraLite®594 Anti-Human CD16 Rabbit RecAb (CL594-98387, Clone: 242426C2) or CoraLite®594 Rabbit IgG Isotype Control RecAb (CL594-98136, Clone: 240953C9). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of human peripheral blood leukocytes using CL594-98387

  1x10^6 human peripheral blood leukocytes were surface stained with 5 ul CoraLite®594 Anti-Human CD16 Rabbit RecAb (CL594-98387, Clone: 242426C2) (red) or CoraLite®594 Rabbit IgG Isotype Control RecAb (CL594-98136, Clone: 240953C9) (blue). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

CD16 Uni-rAb^® Recombinant Antibody for FC

Cat No. CL594-98387

Clone No.242426C2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD16A, CD16a antigen, CD16-II, Fc gamma RIII, Fc gamma RIII alpha

---

Tested Applications

• Positive FC detected in: human peripheral blood leukocytes

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-98387 targets CD16 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg31662

  Product name: Recombinant Human FCGR3A/CD16a (F176V) protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 17-208 aa of BC017865

  Sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ

• Full Name: Fc fragment of IgG, low affinity IIIa, receptor (CD16a)
• Calculated Molecular Weight: 254 aa, 29 kDa
• GenBank Accession Number: BC017865
• Gene Symbol: CD16a
• Gene ID (NCBI): 2214
• ENSEMBL Gene ID: ENSG00000203747
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P08637
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD16 is a 50-70-kDa low affinity Fc receptor found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16 mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. CD16 has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b), encoded by two nearly identical genes, FCGR3A and the FCGR3B.