CD160 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CD160 Polyclonal antibody (34143-1-AP)

• 

  WB analysis using 34143-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34143-1-AP (CD160 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 34143-1-AP

  Mouse spleen tissue were subjected to SDS PAGE followed by western blot with 34143-1-AP (CD160 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CD160 Polyclonal Antibody for WB, ELISA

Cat No. 34143-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Synonyms

By55, CD160 antigen, CD160 antigen, soluble form, Natural killer cell receptor BY55

---

Tested Applications

• Positive WB detected in: rat spleen tissue, mouse spleen tissue, rat thymus tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34143-1-AP targets CD160 in WB, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2585

  Product name: recombinant mouse CD160 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 28-160 aa of NM_001163496.1

  Sequence: GCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWNCSPETNLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHTEIRQRQRSHPDFSHINGTLS

• Full Name: CD160 antigen
• Calculated Molecular Weight: 21kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: NM_001163496.1
• Gene Symbol: Cd160
• Gene ID (NCBI): 54215
• RRID: AB_3743162
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O88875
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD160 is a 27 kDa glycosylphosphatidylinositol (GPI)-anchored glycoprotein expressed on natural killer (NK) cells, T cell subsets (like cytotoxic T lymphocytes), and innate lymphoid cells. It functions as an activating or co-stimulatory receptor, depending on its ligand engagement. Its primary ligands are herpesvirus entry mediator (HVEM) and major histocompatibility complex class I chain-related molecules (MICs). The CD160-HVEM interaction plays a critical dual role: it can deliver co-stimulatory signals to enhance NK/T cell cytotoxicity and cytokine production, but it can also inhibit T cell responses by engaging HVEM-associated signaling pathways. Thus, CD160 is a key regulator in immune cell activation, tumor surveillance, and autoimmune pathology (PMID: 21324341, PMID: 24882258, PMID: 36420268, PMID: 38360636).