CD163 Monoclonal antibody, PBS Only

• 

  WB analysis of human placenta using 68218-1-Ig (same clone as 68218-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 68218-1-Ig (CD163 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68218-1-PBS in a different storage buffer formulation.

• 

  IP experiment of human placenta using 68218-1-Ig (same clone as 68218-1-PBS)

  IP result of anti-CD163 (IP:68218-1-Ig, 4ug; Detection:68218-1-Ig 1:4000) with human placenta tissue lysate 1160 ug. This data was developed using the same antibody clone with 68218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 68218-1-Ig (same clone as 68218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 68218-1-Ig (CD163 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 68218-1-Ig (same clone as 68218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 68218-1-Ig (CD163 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 68218-1-Ig (same clone as 68218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 68218-1-Ig (CD163 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 68218-1-Ig (same clone as 68218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 68218-1-Ig (CD163 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 68218-1-Ig (same clone as 68218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 68218-1-Ig (CD163 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 68218-1-Ig (same clone as 68218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 68218-1-Ig (CD163 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 68218-1-Ig (same clone as 68218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68218-1-Ig (CD163 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 68218-1-Ig (same clone as 68218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68218-1-Ig (CD163 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 68218-1-Ig (same clone as 68218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 68218-1-Ig (CD163 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 68218-1-Ig (same clone as 68218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 68218-1-Ig (CD163 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 68218-1-Ig (same clone as 68218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 68218-1-Ig (CD163 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68218-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver using 68218-1-Ig (same clone as 68218-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using CD163 antibody (68218-1-Ig, Clone: 2G7A5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68218-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver using 68218-1-Ig (same clone as 68218-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using CD163 antibody (68218-1-Ig, Clone: 2G7A5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68218-1-PBS in a different storage buffer formulation.

CD163 Monoclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 68218-1-PBS

Clone No.2G7A5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF-P, IP, Indirect ELISA

Synonyms

Scavenger receptor cysteine-rich type 1 protein M130, MM130, M130, Hemoglobin scavenger receptor, CD163 molecule

---

Product Information

68218-1-PBS targets CD163 in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26721

  Product name: Recombinant human CD163 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 46-401 aa of BC051281

  Sequence: GTDKELRLVDGENKCSGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRWGTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKHQGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDAAVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRG

• Full Name: CD163 molecule
• Calculated Molecular Weight: 1156 aa, 125 kDa
• Observed Molecular Weight: 145-150 kDa
• GenBank Accession Number: BC051281
• Gene Symbol: CD163
• Gene ID (NCBI): 9332
• ENSEMBL Gene ID: ENSG00000177575
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q86VB7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD163 is a transmembrane protein which belongs to the scavenger receptor cysteine-rich (SRCR) superfamily. This protein is a scavenger receptor for the hemoglobin-haptoglobin complex and is a marker for monocytes and macrophages. Soluble CD163 (sCD163), as a result of ectodomain shedding during inflammatory activation of macrophages, circulates in blood and has been suggested as a plasma/serum marker for macrophage activity.