Use Able AI chat for product recommendations

CD163 Monoclonal antibody

CD163 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 68218-1-Ig
Clone No.2G7A5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

2G7A5, CD163 molecule, Hemoglobin scavenger receptor, M130, MM130

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue
Positive IP detected inhuman placenta tissue
Positive IHC detected inhuman liver tissue, human appendicitis tissue, human lung cancer tissue, human placenta tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman liver tissue
Positive IF/ICC detected inIL-4 treated RAW 264.7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:2500-1:10000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68218-1-Ig targets CD163 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26721

Product name: Recombinant human CD163 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 46-401 aa of BC051281

Sequence: GTDKELRLVDGENKCSGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRWGTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKHQGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDAAVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRG

Predict reactive species
Full Name CD163 molecule
Calculated Molecular Weight 1156 aa, 125 kDa
Observed Molecular Weight145-150 kDa
GenBank Accession NumberBC051281
Gene Symbol CD163
Gene ID (NCBI) 9332
ENSEMBL Gene IDENSG00000177575
RRIDAB_2935306
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ86VB7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD163 is a transmembrane protein which belongs to the scavenger receptor cysteine-rich (SRCR) superfamily. This protein is a scavenger receptor for the hemoglobin-haptoglobin complex and is a marker for monocytes and macrophages. Soluble CD163 (sCD163), as a result of ectodomain shedding during inflammatory activation of macrophages, circulates in blood and has been suggested as a plasma/serum marker for macrophage activity.

Protocols

Product Specific Protocols
IF protocol for CD163 antibody 68218-1-IgDownload protocol
IHC protocol for CD163 antibody 68218-1-IgDownload protocol
IP protocol for CD163 antibody 68218-1-IgDownload protocol
WB protocol for CD163 antibody 68218-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseIHC

ACS Appl Bio Mater

Calycosin-7-glucoside-Loaded Hydrogel Promotes Wound Healing in Gestational Diabetes Mellitus

Authors - Jicong Lu

Clin Exp Med

Study on the regulation of Treg cell infiltration by EZH2 through CXCR4/CXCL12 in diffuse large B-cell lymphoma.

Authors - Hongxia Wang
rabbitIF

Mater Today Bio

Mitochondrial biogenesis modulation by silicon-stimulated mesenchymal stem cells-derived extracellular vesicles drives angio- and lymphangiogenesis in chronic wound healing.

Authors - Min-Hua Yu
humanIF

Int J Mol Sci

Identification and Exploration of Pyroptosis-Related Genes in Macrophage Cells Reveal Necrotizing Enterocolitis Heterogeneity Through Single-Cell and Bulk-Sequencing

Authors - Peipei Zhang
humanWB,IF

J Exp Clin Cancer Res

COL10A1+ fibroblasts promote colorectal cancer metastasis and M2 macrophage polarization with pan-cancer relevance

Authors - Shangshang Hu
humanIF

Phytomedicine

Yiqi Huayu Jiedu decoction enhances pathological response in neoadjuvant chemotherapy-treated gastric cancer patients: A prospective, randomized controlled trial.

Authors - Shuo Xu

Reviews

    1.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Clotilde (Verified Customer) (07-13-2026)

This CD163 dos not work in IF-P. The IF was performed on FFPE mouse liver tissue slide with Dako antigen retrival pH9. Primary incubation was performed at 1:200 overnight (16h) at 4°C. Secondary incubation was performed with Goat anti-Rabbit at 1:1000 for 1h at RT. Image were taken with a Leica THUNDER at 10x and 20x magnification.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 200
  • Cell Tissue Type: mouse liver
CD163 Antibody Immunofluorescence validation (200 dilution) in mouse liver (Cat no:68218-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...