Mouse CD164 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse liver using 85723-4-RR (same clone as 85723-4-PBS)

  mouse liver tissue was subjected to SDS PAGE followed by western blot with 85723-4-RR (CD164 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85723-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 85723-4-RR (same clone as 85723-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 85723-4-RR (CD164 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85723-4-PBS in a different storage buffer formulation.

• 

  IF Staining of RM-1 using 85723-4-RR (same clone as 85723-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed RM-1 cells using CD164 antibody (85723-4-RR, Clone: 242986G5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85723-4-PBS in a different storage buffer formulation.

CD164 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 85723-4-PBS

Clone No.242986G5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Endolyn, MGC-24, MGC-24v, MUC-24, Multi-glycosylated core protein 24

---

Product Information

85723-4-PBS targets CD164 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2645

  Product name: Recombinant Mouse CD164 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-162 aa of NM_016898.2

  Sequence: QPNITTLAPNVTEVPTTTTKVVPTTQMPTVLPETCASFNSCVSCVNATFTNNITCFWLHCQEANKTYCANEPLSNCSQVNRTDLCSVIPPTTPVPTNSTAKPTTRPSSPTPTPSVVTSAGTTNTTLTPTSQPERKSTFD

• Full Name: CD164 antigen
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: NM_016898.2
• Gene Symbol: Cd164
• Gene ID (NCBI): 53599
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9R0L9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Sialomucins are a heterogeneous group of secreted or membrane-associated mucins that appear to play 2 key but opposing roles in vivo: first as cytoprotective or antiadhesive agents, and second as adhesion receptors. CD164 is a type I integral transmembrane sialomucin that functions as an adhesion receptor (PMID: 9680353)(PMID: 17077324). Sialomucin CD164 (MUC-24), also referred to multi-glycosylated core protein 24 (MGC24), is known to function as a receptor that regulates stem cell localization to the bone marrow. CD164 may play a key role in hematopoiesis by facilitating the adhesion of CD34+ cells to the stroma and by negatively regulating CD34+CD38(lo/-) cell proliferation. Important role of CD164 in in prostate cancer metastasis, promoting myogenesis and regulating myoblast migration so far have been revealed (PMID: 9763543)(PMID: 16859559)(PMID: 17077324).