CD164 Recombinant monoclonal antibody

• 

  WB analysis of mouse liver using 85723-4-RR

  mouse liver tissue was subjected to SDS PAGE followed by western blot with 85723-4-RR (CD164 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 85723-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 85723-4-RR (CD164 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of RM-1 using 85723-4-RR

  Immunofluorescent analysis of (4% PFA) fixed RM-1 cells using CD164 antibody (85723-4-RR, Clone: 242986G5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

CD164 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 85723-4-RR

Clone No.242986G5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Endolyn, MGC-24, MGC-24v, MUC-24, Multi-glycosylated core protein 24

---

Tested Applications

• Positive WB detected in: mouse liver tissue
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: RM-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85723-4-RR targets CD164 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2645

  Product name: Recombinant Mouse CD164 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-162 aa of NM_016898.2

  Sequence: QPNITTLAPNVTEVPTTTTKVVPTTQMPTVLPETCASFNSCVSCVNATFTNNITCFWLHCQEANKTYCANEPLSNCSQVNRTDLCSVIPPTTPVPTNSTAKPTTRPSSPTPTPSVVTSAGTTNTTLTPTSQPERKSTFD

• Full Name: CD164 antigen
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: NM_016898.2
• Gene Symbol: Cd164
• Gene ID (NCBI): 53599
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9R0L9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sialomucins are a heterogeneous group of secreted or membrane-associated mucins that appear to play 2 key but opposing roles in vivo: first as cytoprotective or antiadhesive agents, and second as adhesion receptors. CD164 is a type I integral transmembrane sialomucin that functions as an adhesion receptor (PMID: 9680353)(PMID: 17077324). Sialomucin CD164 (MUC-24), also referred to multi-glycosylated core protein 24 (MGC24), is known to function as a receptor that regulates stem cell localization to the bone marrow. CD164 may play a key role in hematopoiesis by facilitating the adhesion of CD34+ cells to the stroma and by negatively regulating CD34+CD38(lo/-) cell proliferation. Important role of CD164 in in prostate cancer metastasis, promoting myogenesis and regulating myoblast migration so far have been revealed (PMID: 9763543)(PMID: 16859559)(PMID: 17077324).