CD1e Polyclonal antibody

• 

  WB analysis using 22463-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22463-1-AP (CD1e antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

CD1e Polyclonal Antibody for WB, ELISA

Cat No. 22463-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CD1e molecule, hCD1e, R2, R2G1

---

Tested Applications

• Positive WB detected in: Jurkat cells, MOLT-4 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22463-1-AP targets CD1e in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18008

  Product name: Recombinant human CD1E protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-219 aa of BC131693

  Sequence: APQALQSYHLAAEEQLSFRMLQTSSFANHSWAHSEGSGWLGDLQTHGWDTVLGTIRFLKPWSHGNFSKQELKNLQSLFQLYFHSFIQIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNMAYQGSDFLSFQGISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKPEAWLSCGP

• Full Name: CD1e molecule
• Calculated Molecular Weight: 388 aa, 44 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC131693
• Gene Symbol: CD1E
• Gene ID (NCBI): 913
• RRID: AB_3669398
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P15812
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD1e molecule (CD1e, also known as R2 and CD1A) is a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin (PMID: 10948205). The discoverers of the CD1 locus originally separated CD1 proteins into group 1 (CD1a, CD1b, and CD1c) and group 2 (CD1d), based on amino acid sequence homology (PMID: 2467814). CD1e is an important modulator of group 1 and group 2 CD1-restricted responses influencing the lipid antigen availability and the generation and persistence of CD1-lipid complexes (PMID: 21844346).