Mouse CD2 Recombinant monoclonal antibody, PBS Only (Detector)

CD2 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 84360-4-PBS
Clone No.241548D7

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

241548D7, LFA-2, LFA-3 receptor, Ly-37, Lymphocyte antigen 37

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84360-4-PBS targets CD2 as part of a matched antibody pair:

MP01249-1: 84360-5-PBS capture and 84360-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1403

Product name: Recombinant Mouse CD2 protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 23-203 aa of NM_013486.2

Sequence: RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLS

Predict reactive species
Full Name CD2 antigen
Calculated Molecular Weight38 kDa
Observed Molecular Weight60 kDa
GenBank Accession NumberNM_013486.2
Gene Symbol CD2
Gene ID (NCBI) 12481
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP08920
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD2 is a cell surface glycoprotein present on a majority of thymocytes, all mature T cells and subset of NK cells but not on B lymphocytes. It is a pan T-cell marker. CD2 interacts with lymphocyte function-associated antigen (LFA-3/CD58) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function.

Loading...
||
New chat

Able

正在加载,请稍候...