Anti-Mouse CD2 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of mouse splenocytes using 98193-1-RR (same clone as 98193-1-PBS)

  1x10^6 mouse splenocytes were surface stained with 0.15 ug Anti-Mouse CD2 Rabbit Recombinant Antibody (98193-1-RR, Clone: 241548A5) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) and PE-conjugated Goat Anti-Rabbit IgG. Cells were co-stained with CoraLite® Plus 647 Anti-Mouse CD19. Cells were not fixed. This data was developed using the same antibody clone with 98193-1-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse splenocytes using 98193-1-RR (same clone as 98193-1-PBS)

  1x10^6 mouse splenocytes were surface stained with 0.15 ug Anti-Mouse CD2 Rabbit Recombinant Antibody (98193-1-RR, Clone:241548A5) (red) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue) and PE-conjugated Goat Anti-Rabbit IgG. Cells were not fixed. This data was developed using the same antibody clone with 98193-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98193-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98193-1-RR against Mouse CD2 were performed. The affinity constant is below 1 pM.

CD2 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98193-1-PBS

Clone No.241548A5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

241548A5, LFA-2, LFA-3 receptor, Ly-37, Lymphocyte antigen 37

---

Product Information

98193-1-PBS targets CD2 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1403

  Product name: Recombinant Mouse CD2 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 23-203 aa of NM_013486.2

  Sequence: RDNETIWGVLGHGITLNIPNFQMTDDIDEVRWVRRGTLVAEFKRKKPPFLISETYEVLANGSLKIKKPMMRNDSGTYNVMVYGTNGMTRLEKDLDVRILERVSKPMIHWECPNTTLTCAVLQGTDFELKLYQGETLLNSLPQKNMSYQWTNLNAPFKCEAINPVSKESKMEVVNCPEKGLS

• Full Name: CD2 antigen
• Calculated Molecular Weight: 38 kDa
• GenBank Accession Number: NM_013486.2
• Gene Symbol: CD2
• Gene ID (NCBI): 12481
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P08920
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD2 is a cell surface glycoprotein present on a majority of thymocytes, all mature T cells and subset of NK cells but not on B lymphocytes. It is a pan T-cell marker. CD2 interacts with lymphocyte function-associated antigen (LFA-3/CD58) and CD48/BCM1 to mediate adhesion between T-cells and other cell types. CD2 is implicated in the triggering of T-cells, the cytoplasmic domain is implicated in the signaling function.