Tested Applications
| Positive IF-P detected in | mouse spleen tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
PE-31909 targets CD20 in IF-P applications and shows reactivity with mouse, rat samples.
| Tested Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36918 Product name: Recombinant mouse Ms4a1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 204-291 aa of NM_007641 Sequence: GIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP* Predict reactive species |
| Full Name | membrane-spanning 4-domains, subfamily A, member 1 |
| Calculated Molecular Weight | 32 kDa |
| GenBank Accession Number | NM_007641 |
| Gene Symbol | Ms4a1 |
| Gene ID (NCBI) | 12482 |
| Conjugate | PE Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 496 nm, 565 nm / 578 nm |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P19437 |
| Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
CD20 is a 33-37 kDa transmembrane phosphoprotein. CD20 is a B-lymphocyte surface molecule that is widely expressed during B-cell ontogeny, from early pre-B-cell developmental stages until final differentiation into plasma cells. CD20 functions as a calcium-permeable cation channel. It is involved in the regulation of B-cell activation and proliferation. CD20 serves as a useful target for antibody-mediated therapeutic depletion of B-cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PE CD20 antibody PE-31909 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

