PE-conjugated CD20 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PE-conjugated CD20 Polyclonal antibody (PE-31909)

CD20 Polyclonal Antibody for IF-P

Cat No. PE-31909

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

IF-P

Synonyms

B-cell differentiation antigen Ly-44, B-lymphocyte antigen CD20, Lymphocyte antigen 44, Membrane-spanning 4-domains subfamily A member 1

• 

  IF Staining of mouse spleen using PE-31909

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using PE CD20 antibody (PE-31909) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IF-P detected in: mouse spleen tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

PE-31909 targets CD20 in IF-P applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36918

  Product name: Recombinant mouse Ms4a1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 204-291 aa of NM_007641

  Sequence: GIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP*

• Full Name: membrane-spanning 4-domains, subfamily A, member 1
• Calculated Molecular Weight: 32 kDa
• GenBank Accession Number: NM_007641
• Gene Symbol: Ms4a1
• Gene ID (NCBI): 12482
• Conjugate: PE Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P19437
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD20 is a 33-37 kDa transmembrane phosphoprotein. CD20 is a B-lymphocyte surface molecule that is widely expressed during B-cell ontogeny, from early pre-B-cell developmental stages until final differentiation into plasma cells. CD20 functions as a calcium-permeable cation channel. It is involved in the regulation of B-cell activation and proliferation. CD20 serves as a useful target for antibody-mediated therapeutic depletion of B-cells.