FcZero-rAb® Biotin Anti-Mouse CD200 Rabbit Recombinant Antibody

• 

  FC experiment of mouse splenocytes using Biotin-FcA98039

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Biotin Anti-Mouse CD200 Rabbit RecAb (Biotin-FcA98039, Clone: 240391A6) or 0.25 ug FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9), and PE Streptavidin (Cat.No. PF00021). Cells were co-stained with APC Anti-Mouse CD45R. Cells were not fixed.

• 

  FC experiment of mouse splenocytes using Biotin-FcA98039

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Biotin Anti-Mouse CD200 Rabbit RecAb (Biotin-FcA98039, Clone: 240391A6) (red) or 0.25 ug FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9) (blue), and PE Streptavidin (Cat.No. PF00021). Cells were not fixed.

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD200 FcZero-rAb^® Recombinant Antibody for FC, ELISA

Cat No. Biotin-FcA98039

Clone No.240391A6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC, ELISA

Synonyms

CD200 antigen, Mox2, OX2

---

Tested Applications

• Positive FC detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98039 targets CD200 in FC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0920

  Product name: Recombinant mouse CD200 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 31-232 aa of /

  Sequence: QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG

• Full Name: CD200 antigen
• Calculated Molecular Weight: 31 kDa
• GenBank Accession Number: /
• Gene Symbol: Cd200
• Gene ID (NCBI): 17470
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O54901
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD200, also known as OX2, is a type I transmembrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 3032785). It contains two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. CD200 is expressed on a variety of cell types, including thymocytes, B lymphocytes, a subset of T lymphocytes, follicular dendritic cells, neurons, and endothelial cells (PMID: 3032785; 10981966). CD200 binds to its receptor, CD200R, which is primarily expressed by myeloid and T cell lineage (PMID: 15187158). The CD200-CD200R interaction plays a role in immunosuppression and suppression of anti-tumor immune responses (PMID: 22020332).