CD207 Monoclonal antibody

• 

  IHC staining of human skin cancer using 67788-1-Ig

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 67788-1-Ig (CD207 antibody) at dilution of 1:20000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin cancer using 67788-1-Ig

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 67788-1-Ig (CD207 antibody) at dilution of 1:20000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin cancer using 67788-1-Ig

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 67788-1-Ig (CD207 antibody) at dilution of 1:20000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD207 Monoclonal Antibody for IHC, ELISA

Cat No. 67788-1-Ig

Clone No.1H3A1

Publications(2)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

Langerin, C-type lectin domain family 4 member K, CLEC4K, CD207 molecule, langerin, 1H3A1

---

Tested Applications

• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:5000-1:20000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

67788-1-Ig targets CD207 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2479

  Product name: Recombinant human CD207 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-328 aa of BC022278

  Sequence: MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP

• Full Name: CD207 molecule, langerin
• Calculated Molecular Weight: 328 aa, 37 kDa
• GenBank Accession Number: BC022278
• Gene Symbol: CD207
• Gene ID (NCBI): 50489
• RRID: AB_2918552
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UJ71
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Elife; Cryo-electron tomography of Birbeck granules reveals the molecular mechanism of langerin lattice formation.; Authors - Toshiyuki Oda
human	IF	Bioeng Transl Med; Assessing the impact of airborne particulate pollution on human skin utilizing a novel human skin equivalent containing MUTZ-3-derived Langerhans cells; Authors - Amy Simpson

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Federica (Verified Customer) (11-10-2023)

Stainig done with Leica Bond RXm, Red Chromogen Kit, Antigen Retrival ER2 100C for 30min

• Applications: Immunohistochemistry
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: Skin - Atopic Dermatitis

CD207 Antibody Immunohistochemistry validation (1:2000 dilution) in Skin - Atopic Dermatitis (Cat no:67788-1-Ig)