CD207 Monoclonal antibody, PBS Only

• 

  IHC staining of human skin cancer using 67788-1-Ig (same clone as 67788-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 67788-1-Ig (CD207 antibody) at dilution of 1:20000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67788-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 67788-1-Ig (same clone as 67788-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 67788-1-Ig (CD207 antibody) at dilution of 1:20000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67788-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 67788-1-Ig (same clone as 67788-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 67788-1-Ig (CD207 antibody) at dilution of 1:20000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67788-1-PBS in a different storage buffer formulation.

CD207 Monoclonal Antibody for IHC, Indirect ELISA

Cat No. 67788-1-PBS

Clone No.1H3A1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Langerin, C-type lectin domain family 4 member K, CLEC4K, CD207 molecule, langerin, 1H3A1

---

Product Information

67788-1-PBS targets CD207 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2479

  Product name: Recombinant human CD207 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-328 aa of BC022278

  Sequence: MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP

• Full Name: CD207 molecule, langerin
• Calculated Molecular Weight: 328 aa, 37 kDa
• GenBank Accession Number: BC022278
• Gene Symbol: CD207
• Gene ID (NCBI): 50489
• RRID: AB_2918552
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UJ71
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.