FcZero-rAb® Biotin Anti-Human CD209 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® Biotin Anti-Human CD209 Rabbit Recombinant Antibody (Biotin-FcA98156)

• 

  FC experiment of human monocyte-derived dendritic using Biotin-FcA98156

  1x10^6 human monocyte-derived dendritic cells were surface stained with 0.25 ug Biotin Anti-Human CD209 Rabbit RecAb (Biotin-FcA98156, Clone: 240907A4) (red) or 0.25 ug FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9), and PE-conjugated streptavidin. Cells were not fixed.

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD209 FcZero-rAb^® Recombinant Antibody for FC, ELISA

Cat No. Biotin-FcA98156

Clone No.240907A4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC, ELISA

Synonyms

DC-SIGN, CLEC4L, C-type lectin domain family 4 member L, DC SIGN, DC SIGN1

---

Tested Applications

• Positive FC detected in: human monocyte-derived dendritic cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98156 targets CD209 in FC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0062

  Product name: Recombinant Human CD209 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: N-6*his

  Domain: 59-404 aa of BC110615

  Sequence: QVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

• Full Name: CD209 molecule
• Calculated Molecular Weight: 404 aa, 45.7 kDa
• GenBank Accession Number: BC110615
• Gene Symbol: CD209
• Gene ID (NCBI): 30835
• RRID: AB_3746946
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NNX6
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD209 (DC-SIGN, CLEC4L) is a C-type lectin receptor that is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens, including bacteria, viruses, and parasites. CD209 is preferentially expressed on dendritic cells (DCs). It mediates transient adhesion of DCs with T cells. It has been reported that CD209 plays a role in capture and transmission of HIV from DC to T cells (PMID: 10721995).