CoraLite®594 Anti-Human CD209 Rabbit Recombinant Antibody

CD209 Uni-rAb® Recombinant Antibody for FC
Cat No. CL594-98156
Clone No.240907A4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

240907A4, CDSIGN, CLEC4L, C-type lectin domain family 4 member L, DC SIGN

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman monocyte-derived immature dendritic cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-98156 targets CD209 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0062

Product name: Recombinant Human CD209 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: N-6*his

Domain: 59-404 aa of BC110615

Sequence: QVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

Predict reactive species
Full Name CD209 molecule
Calculated Molecular Weight 404 aa, 45.7 kDa
GenBank Accession NumberBC110615
Gene Symbol CD209
Gene ID (NCBI) 30835
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NNX6
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD209 (DC-SIGN, CLEC4L) is a C-type lectin receptor that is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens, including bacteria, viruses, and parasites. CD209 is preferentially expressed on dendritic cells (DCs). It mediates transient adhesion of DCs with T cells. It has been reported that CD209 plays a role in capture and transmission of HIV from DC to T cells (PMID: 10721995).

Protocols

Product Specific Protocols
FC protocol for CL594 CD209 antibody CL594-98156Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...