CD23 Polyclonal antibody

• 

  WB analysis of Raji using 18642-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 18642-1-AP (FCER2,CD23 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 18642-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 18642-1-AP (CD23 antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 18642-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 18642-1-AP (CD23 antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 18642-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 18642-1-AP (FCER2,CD23 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieved with Tris-EDTA buffer, pH9.0.

• 

  IHC staining of human tonsillitis using 18642-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 18642-1-AP (FCER2,CD23 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieved with Tris-EDTA buffer, pH9.0.

• 

  IHC staining of human lymphoma using 18642-1-AP

  Immunohistochemical analysis of paraffin-embedded human diffuse small B-cell lymphoma tissue slide using 18642-1-AP (FCER2,CD23 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lymphoma using 18642-1-AP

  Immunohistochemical analysis of paraffin-embedded human diffuse small B-cell lymphoma tissue slide using 18642-1-AP (FCER2,CD23 Antibody) at dilution of 1:50 (under 40x lens).

CD23 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18642-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Fc epsilon RII, C-type lectin domain family 4 member J, CLEC4J, CD23A, BLAST-2

---

Tested Applications

• Positive WB detected in: Raji cells
• Positive IHC detected in: human tonsillitis tissue, human lymphoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:800-1:3200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

18642-1-AP targets CD23 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13348

  Product name: Recombinant human FCER2,CD23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-321 aa of BC014108

  Sequence: MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

• Full Name: Fc fragment of IgE, low affinity II, receptor for (CD23)
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 38-42 kDa
• GenBank Accession Number: BC014108
• Gene Symbol: CD23
• Gene ID (NCBI): 2208
• RRID: AB_2878555
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P06734
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD23, also known as low affinity immunoglobulin epsilon Fc receptor, is a transmembrane glycoprotein present on a subpopulation of B lymphocytes in germinal centres, EBV-transformed B-lymphoblastoid cell lines, follicular dendritic cells, and a subpopulation of peripheral blood cells. CD23 has essential roles in the regulation of IgE production and in the differentiation of B-cells.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	World J Surg Oncol; The correlation of tertiary lymphoid structures with tumor spread through air spaces and prognosis in lung adenocarcinoma: focusing on pathological spatial features; Authors - Yun Ding