Anti-Mouse CD23 Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse CD23 Rabbit Recombinant Antibody, PBS Only (98164-1-PBS)

CD23 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98164-1-PBS

Clone No.241385D1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

241385D1, Fc-epsilon-RII, Fcer2, Fcer2a, Low affinity immunoglobulin epsilon Fc receptor

• 

  FC experiment of mouse splenocytes using 98164-1-RR (same clone as 98164-1-PBS)

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD23 Rabbit Recombinant Antibody (98164-1-RR, Clone: 241385D1) or 0.25 ug Isotype Control, and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with CoraLite® Plus 647 Anti-Mouse CD19. Cells were not fixed. This data was developed using the same antibody clone with 98164-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using 98164-1-RR (same clone as 98164-1-PBS)

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD23 Rabbit Recombinant Antibody (98164-1-RR, Clone: 241385D1) (red) or 0.25 ug Isotype Control (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98164-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 98164-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98164-1-RR against Mouse CD23 were performed. The affinity constant is 1.10 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

98164-1-PBS targets CD23 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1295

  Product name: Recombinant Mouse CD23 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: N-6*His

  Domain: 51-331 aa of EDL21948.1

  Sequence: TEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASVTPTRPTPKSEP

• Full Name: Fc receptor, IgE, low affinity II, alpha polypeptide
• Calculated Molecular Weight: 38 kDa
• GenBank Accession Number: EDL21948.1
• Gene Symbol: Fcer2a
• Gene ID (NCBI): 14128
• RRID: AB_3672307
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P20693-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD23, also known as low-affinity immunoglobulin epsilon Fc receptor, is a transmembrane glycoprotein present on a subpopulation of B lymphocytes in germinal centers, EBV-transformed B-lymphoblastoid cell lines, follicular dendritic cells, and a subpopulation of peripheral blood cells. CD23 has essential roles in the regulation of IgE production and in the differentiation of B cells.