Use Able AI chat for product recommendations

CoraLite®594-conjugated CD23 Monoclonal antibody

CD23 Monoclonal Antibody for IF-P

Cat No. CL594-60208-2
Clone No. 4C7C9
Publications (1)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

IF-P

C-type lectin domain family 4 member J, CLEC4J, CD23A, BLAST-2, BLAST 2

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CD23 in ?

Tested Applications

Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-60208-2 targets CD23 in IF-P applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0425

Product name: Recombinant human CD23,FCER2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 48-248 aa of BC064417

Sequence: DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPG

Predict reactive species
Full Name Fc fragment of IgE, low affinity II, receptor for (CD23)
Calculated Molecular Weight 321 aa, 36 kDa
Observed Molecular Weight 40 kDa
GenBank Accession NumberBC064417
Gene Symbol CD23
Gene ID (NCBI) 2208
RRIDAB_3748090
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP06734
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD23, also known as low affinity immunoglobulin epsilon Fc receptor, is a transmembrane glycoprotein present on a subpopulation of B lymphocytes in germinal centres, EBV-transformed B-lymphoblastoid cell lines, follicular dendritic cells, and a subpopulation of peripheral blood cells. CD23 has essential roles in the regulation of IgE production and in the differentiation of B-cells.

Protocols

Product Specific Protocols
IF protocol for CL594 CD23 antibody CL594-60208-2Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

CD23 Monoclonal antibody (4C7C9), catalog number CL594-60208-2, has 1 citation. The paper was published in Cancer Cell Int and focuses on single-cell spatial analysis of ID1-high endothelial cells in tertiary lymphoid structures as predictors of durable immunotherapy response in non-small cell lung cancer. The antibody was used for immunofluorescence (IF) on human samples.

SpeciesApplicationTitle
humanIF

Cancer Cell Int

Single-cell spatial analysis identifies ID1-high endothelial cells in tertiary lymphoid structures as predictors of durable response to immunotherapy in non-small cell lung cancer.

Authors - Kinnosuke Matsumoto
Loading...
||
New chat

Able™

正在加载,请稍候...