CoraLite®594-conjugated CD23 Monoclonal antibody

CD23 Monoclonal Antibody for IF-P
Cat No. CL594-60208-2
Clone No.4C7C9

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

IF-P

C-type lectin domain family 4 member J, CLEC4J, CD23A, BLAST-2, BLAST 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-60208-2 targets CD23 in IF-P applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0425

Product name: Recombinant human CD23,FCER2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 48-248 aa of BC064417

Sequence: DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPG

Predict reactive species
Full Name Fc fragment of IgE, low affinity II, receptor for (CD23)
Calculated Molecular Weight 321 aa, 36 kDa
Observed Molecular Weight 40 kDa
GenBank Accession NumberBC064417
Gene Symbol CD23
Gene ID (NCBI) 2208
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP06734
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD23, also known as low affinity immunoglobulin epsilon Fc receptor, is a transmembrane glycoprotein present on a subpopulation of B lymphocytes in germinal centres, EBV-transformed B-lymphoblastoid cell lines, follicular dendritic cells, and a subpopulation of peripheral blood cells. CD23 has essential roles in the regulation of IgE production and in the differentiation of B-cells.

Protocols

Product Specific Protocols
IF protocol for CL594 CD23 antibody CL594-60208-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...