CD244 Recombinant monoclonal antibody, PBS Only (Capture)

CD244 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 84086-2-PBS
Clone No.241260E3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

SLAMF4, 2B4, h2B4, NAIL, NK cell activation-inducing ligand

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84086-2-PBS targets CD244 as part of a matched antibody pair:

MP01008-1: 84086-2-PBS capture and 84086-4-PBS detection (validated in Cytometric bead array)

MP01008-2: 84086-2-PBS capture and 84086-3-PBS detection (validated in Cytometric bead array)

MP01008-3: 84086-2-PBS capture and 84086-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg32087

Product name: Recombinant Human CD244 protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 22-221 aa of BC053985

Sequence: CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR

Predict reactive species
Full Name CD244 molecule, natural killer cell receptor 2B4
Calculated Molecular Weight 365 aa, 41 kDa
GenBank Accession NumberBC053985
Gene Symbol CD244
Gene ID (NCBI) 51744
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BZW8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...