• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® APC Anti-Human CD244 Rabbit Recombinant Antibody

CD244 FcZero-rAb® Recombinant Antibody for FC
Cat No. APC-FcA98133
Clone No.241260G10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

SLAMF4, 241260G10, 2B4, h2B4, NAIL

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98133 targets CD244 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg32087

Product name: Recombinant Human CD244 protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 22-221 aa of BC053985

Sequence: CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR

Predict reactive species
Full Name CD244 molecule, natural killer cell receptor 2B4
Calculated Molecular Weight 365 aa, 41 kDa
GenBank Accession NumberBC053985
Gene Symbol CD244
Gene ID (NCBI) 51744
Conjugate APC Fluorescent Dye
Excitation/Emission Maxima Wavelengths650 nm / 660 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BZW8
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD244, also known as SLAMF4 or 2B4, is a type I transmembrane glycoprotein belonging to the signaling lymphocyte activation molecule (SLAM) family. It consists of an extracellular segment with two immunoglobulin (Ig)-like domains, a transmembrane region, and a cytoplasmic domain containing tyrosine-based motifs (PMID: 9841922; 30546369). CD244 is present on natural killer (NK) cells, γδ T cells, a subset of CD8+ T cells, monocytes, basophils, dendritic cells, and myeloid-derived suppressor cells (MDSCs) (PMID: 30546369). It binds to CD48 with high affinity and transmits stimulatory or inhibitory signals that regulate immune function (PMID: 9841922; 18523281).

Protocols

Product Specific Protocols
FC protocol for APC CD244 antibody APC-FcA98133Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...