Anti-Mouse CD25/IL-2RA Rabbit Recombinant Antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse CD25/IL-2RA Rabbit Recombinant Antibody, PBS Only (98288-1-PBS)

• 

  FC experiment of mouse splenocytes using 98288-1-RR (same clone as 98288-1-PBS)

  1x10^6 untreated or anti-CD3/CD28 treated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD25/IL-2RA Rabbit RecAb (98288-1-RR, Clone: 242494H5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with CoraLite® Plus 750 Anti-Mouse CD4 (GK1.5) (CL750-65104, Clone: GK1.5). Cells were not fixed. This data was developed using the same antibody clone with 98288-1-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse splenocytes using 98288-1-RR (same clone as 98288-1-PBS)

  1x10^6 anti-CD3/CD28 treated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD25/IL-2RA Rabbit RecAb (98288-1-RR, Clone: 242494H5) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD25/IL-2RA Rabbit RecAb (98288-1-RR, Clone: 242494H5) (black, dashed) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98288-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98288-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98288-1-RR against Mouse CD25/IL-2RA were performed. The affinity constant is below 1 pM.

CD25/IL-2RA Uni-rAb^® Recombinant Antibody for FC

Cat No. 98288-1-PBS

Clone No.242494H5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD25, 242494H5, IL-2 receptor subunit alpha, Il2r, IL-2R subunit alpha

---

Product Information

98288-1-PBS targets CD25/IL-2RA in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3087

  Product name: Recombinant Mouse CD25/IL2RA protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-236 aa of NM_008367.3

  Sequence: ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK

• Full Name: interleukin 2 receptor, alpha chain
• Calculated Molecular Weight: 31 kDa
• GenBank Accession Number: NM_008367.3
• Gene Symbol: CD25
• Gene ID (NCBI): 16184
• RRID: AB_3745954
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P01590
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Proliferation of T lymphocytes is triggered by the interaction of IL-2 with its specific receptor following T lymphocyte activation. The receptor for IL-2 has three forms, generated by different combinations of three different proteins, the alpha chain (IL-2R alpha), the beta chain (IL-2R beta), and the gamma chain (IL-2R gamma) (PMID: 8476561). IL-2R alpha (also known as CD25) is a type I transmembrane protein present on activated T cells, activated B cells, some thymocytes, myeloid precursors, and oligodendrocytes. CD25 is also found on natural CD4+Foxp3+ Treg cells and a subset of human CD4+ memory T cells (PMID: 22585674).