Anti-Mouse CD25/IL-2RA Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse CD25/IL-2RA Rabbit Recombinant Antibody (98288-1-RR)

• 

  FC experiment of mouse splenocytes using 98288-1-RR

  1x10^6 untreated or anti-CD3/CD28 treated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD25/IL-2RA Rabbit RecAb (98288-1-RR, Clone: 242494H5) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with CoraLite® Plus 750 Anti-Mouse CD4 (GK1.5) (CL750-65104, Clone: GK1.5). Cells were not fixed.

• 

  FC experiment of mouse splenocytes using 98288-1-RR

  1x10^6 anti-CD3/CD28 treated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD25/IL-2RA Rabbit RecAb (98288-1-RR, Clone: 242494H5) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). 1x10^6 untreated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse CD25/IL-2RA Rabbit RecAb (98288-1-RR, Clone: 242494H5) (black, dashed) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

• 

  Affinity and Kinetic Characterization of 98288-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98288-1-RR against Mouse CD25/IL-2RA were performed. The affinity constant is below 1 pM.

CD25/IL-2RA Uni-rAb^® Recombinant Antibody for FC

Cat No. 98288-1-RR

Clone No.242494H5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD25, 242494H5, IL-2 receptor subunit alpha, Il2r, IL-2R subunit alpha

---

Tested Applications

• Positive FC detected in: Anti-CD3/CD28 treated mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98288-1-RR targets CD25/IL-2RA in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3087

  Product name: Recombinant Mouse CD25/IL2RA protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-236 aa of NM_008367.3

  Sequence: ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK

• Full Name: interleukin 2 receptor, alpha chain
• Calculated Molecular Weight: 31 kDa
• GenBank Accession Number: NM_008367.3
• Gene Symbol: CD25
• Gene ID (NCBI): 16184
• RRID: AB_3745954
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P01590
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Proliferation of T lymphocytes is triggered by the interaction of IL-2 with its specific receptor following T lymphocyte activation. The receptor for IL-2 has three forms, generated by different combinations of three different proteins, the alpha chain (IL-2R alpha), the beta chain (IL-2R beta), and the gamma chain (IL-2R gamma) (PMID: 8476561). IL-2R alpha (also known as CD25) is a type I transmembrane protein present on activated T cells, activated B cells, some thymocytes, myeloid precursors, and oligodendrocytes. CD25 is also found on natural CD4+Foxp3+ Treg cells and a subset of human CD4+ memory T cells (PMID: 22585674).