• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® APC Anti-Mouse CD27 Rabbit Recombinant Antibody

CD27 FcZero-rAb® Recombinant Antibody for FC
Cat No. APC-FcA98160
Clone No.241378E11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

241378E11, CD27 antigen, CD27L receptor, T-cell activation antigen CD27, Tnfrsf7

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.1 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98160 targets CD27 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1311

Product name: Recombinant Mouse CD27 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 21-182 aa of NM_001033126.2

Sequence: TLAPNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR

Predict reactive species
Full Name CD27 antigen
Calculated Molecular Weight28kDa
GenBank Accession NumberNM_001033126.2
Gene Symbol CD27
Gene ID (NCBI) 21940
Conjugate APC Fluorescent Dye
Excitation/Emission Maxima Wavelengths650 nm / 660 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP41272
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD27 (also known as TNFRSF7) is a type I glycoprotein expressed on some B cells and the majority of T cells, and is a member of the tumor necrosis factor (TNF) receptor family. CD27 is required for generation and long-term maintenance of T cell immunity (PMID: 11062504). It is a receptor for CD70 (CD27L). Ligation of CD27 by CD70 induces strong ubiquitination of TRAF and the activation of both canonical and non-canonical NF-kappaB pathways, as well as the JNK pathway (PMID: 19426224). CD27 may also play a role in apoptosis through association with SIVA1.

Protocols

Product Specific Protocols
FC protocol for APC CD27 antibody APC-FcA98160Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...