Mouse CD27 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP01069-2

  Sandwich ELISA standard curve of MP01069-2, Mouse CD27 Recombinant Matched Antibody Pair - PBS only. 84157-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg1311. 84157-4-PBS was HRP conjugated as the detection antibody. Range: 9.77-625 pg/mL.

• 

  Sample test of MP01069-2

  The mean CD27 concentration was determined to be 89.6 ng/mL in mouse thymus tissue extract based on a 1.3 mg/mL extract load and 22.2 ng/mL in mouse spleen tissue extract based on a 2.9 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP01069-2

  Cytometric bead array standard curve of MP01069-2, MOUSE CD27/TNFRSF7 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84157-2-PBS. Detection antibody: 84157-4-PBS. Standard: Eg1311. Range: 0.781-50 ng/mL.

CD27 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84157-4-PBS

Clone No.241378E11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

CD27 antigen, CD27L receptor, T-cell activation antigen CD27, Tnfrsf7, Tumor necrosis factor receptor superfamily member 7

---

Product Information

84157-4-PBS targets CD27 as part of a matched antibody pair:

MP01069-2: 84157-2-PBS capture and 84157-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1311

  Product name: Recombinant Mouse CD27 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 21-182 aa of NM_001033126.2

  Sequence: TLAPNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR

• Full Name: CD27 antigen
• Calculated Molecular Weight: 28kDa
• GenBank Accession Number: NM_001033126.2
• Gene Symbol: CD27
• Gene ID (NCBI): 21940
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P41272
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.