CD28 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP00136-5

  Sandwich ELISA standard curve of MP00136-5, Human CD28 Monoclonal Matched Antibody Pair - PBS only. 83383-8-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg0889. 83383-2-PBS was HRP conjugated as the detection antibody. Range: 78.125-5000 pg/mL.

• 

  Sample test of MP00136-5

  Serum of sixteen individual healthy human donors were measured. The human CD28 concentration of detected samples was determined to be 879.1 pg/mL with a range of 287.8 - 2,540.7 pg/mL.

CD28 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83383-2-PBS

Clone No.240353H7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

CD28 molecule, T-cell-specific surface glycoprotein CD28, Tp44

---

Product Information

83383-2-PBS targets CD28 as part of a matched antibody pair:

MP00136-5: 83383-8-PBS capture and 83383-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0889

  Product name: Recombinant Human CD28 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 19-152 aa of BC093698

  Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

• Full Name: CD28 molecule
• Calculated Molecular Weight: 220 aa, 25 kDa
• GenBank Accession Number: BC093698
• Gene Symbol: CD28
• Gene ID (NCBI): 940
• ENSEMBL Gene ID: ENSG00000178562
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10747
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.