FcZero-rAb® Biotin Anti-Mouse CD28 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® Biotin Anti-Mouse CD28 Rabbit Recombinant Antibody (Biotin-FcA98195)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD28 FcZero-rAb^® Recombinant Antibody for FC, ELISA

Cat No. Biotin-FcA98195 Copied!

Clone No. 241707H6

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC, ELISA

Synonyms

CD28 antigen, T-cell-specific surface glycoprotein CD28

• 

  FC experiment of mouse splenocytes using Biotin-FcA98195

  1x10^6 mouse splenocytes were surface stained with FcZero-rAb™ APC Anti-Mouse CD3e, 0.25 ug Biotin Anti-Mouse CD28 Rabbit RecAb (Biotin-FcA98195, Clone:241707H6) or 0.25 ug FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9), and PE-conjugated streptavidin. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using Biotin-FcA98195

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Biotin Anti-Mouse CD28 Rabbit RecAb (Biotin-FcA98195, Clone: 241707H6) (red) or 0.25 ug FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9) (blue), and PE-conjugated streptavidin. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using Biotin-FcA98195

  1x10^6 mouse splenocytes were activated with FcZero-rAb® Biotin Anti-Mouse CD28 Rabbit Recombinant Antibody, and then were surface stained with APC Anti-Mouse CD25/IL-2RA (APC-65137, Clone: PC61.5) and CoraLite®594 Anti-Mouse CD69 (CL594-65105, Clone: H1.2F3). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD28 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98195 targets CD28 in FC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1408

  Product name: Recombinant Mouse CD28 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 20-150 aa of NM_007642.4

  Sequence: NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKL

• Full Name: CD28 antigen
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: NM_007642.4
• Gene Symbol: Cd28
• Gene ID (NCBI): 12487
• RRID: AB_3746964
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P31041
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD28 (T-cell-specific surface glycoprotein CD28), also known as T44 and Tp44, is a 44 kD disulfide-linked homodimeric type I glycoprotein (PMID: 2162180). It is a member of the immunoglobulin superfamily and is expressed on most T lineage cells, NK cell subsets, and plasma cells (PMID: 2162180, 8386518). CD28 may affect in vivo immune responses by functioning both as a cell adhesion molecule linking B and T lymphocytes and as the surface component of a novel signal transduction pathway (PMID: 2162180, 3021470). CD28 binds both CD80 and CD86 with a highly conserved motif MYPPY in the CDR3-like loop (PMID: 15696168, 7964482). CD28 is considered a major co-stimulatory molecule, inducing T lymphocyte activation and IL-2 synthesis, and preventing cell death (PMID: 1348520).