CoraLite®594-conjugated CD3 Recombinant monoclonal antibody

CD3 Uni-rAb® Recombinant Antibody for IF/ICC, IF-P
Cat No. CL594-84505-4
Clone No.242012G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, IF-P

CD3E, CD3 epsilon, CD3-epsilon, T3E, T-cell surface antigen T3/Leu-4 epsilon chain

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue
Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-84505-4 targets CD3 in IF/ICC, IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2144

Product name: Recombinant Human CD3 epsilon protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 23-126 aa of BC049847

Sequence: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Predict reactive species
Full Name CD3e molecule, epsilon (CD3-TCR complex)
Calculated Molecular Weight 207 aa, 23 kDa
Observed Molecular Weight23 kDa
GenBank Accession NumberBC049847
Gene Symbol CD3
Gene ID (NCBI) 916
ENSEMBL Gene IDENSG00000198851
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07766
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. This antibody is directed against the epsilon chain of human CD3 molecule.

Protocols

Product Specific Protocols
IF protocol for CL594 CD3 antibody CL594-84505-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...