Rat CD3 epsilon Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 86053-1-RR (same clone as 86053-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86053-1-RR (CD3 epsilon/CD3e antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.

• 

  WB analysis of CTLL-2 using 86053-1-RR (same clone as 86053-1-PBS)

  CTLL-2 cells were subjected to SDS PAGE followed by western blot with 86053-1-RR (CD3 epsilon/CD3e antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02251-2

  The mean CD3 epsilon concentration was determined to be 6.3 ng/mL in rat heart tissue extract based on a 6.7 mg/mL extract load and 13.6 ng/mL in rat spleen tissue extract based on a 2.7 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02251-2

  Sandwich ELISA standard curve of MP02251-2, Rat CD3 epsilon Recombinant Matched Antibody Pair - PBS only. 86053-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg1450. 86053-1-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL.

• 

  IHC staining of rat spleen using 86053-1-RR (same clone as 86053-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 86053-1-RR (CD3 epsilon antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat spleen using 86053-1-RR (same clone as 86053-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 86053-1-RR (CD3 epsilon antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat thymus using 86053-1-RR (same clone as 86053-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat thymus tissue slide using 86053-1-RR (CD3 epsilon antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat thymus using 86053-1-RR (same clone as 86053-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat thymus tissue slide using 86053-1-RR (CD3 epsilon antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat thymus using 86053-1-RR (same clone as 86053-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat thymus tissue using CD3 epsilon antibody (86053-1-RR, Clone: 242849D3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat thymus using 86053-1-RR (same clone as 86053-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat thymus tissue using CD3 epsilon antibody (86053-1-RR, Clone: 242849D3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat spleen using 86053-1-RR (same clone as 86053-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat spleen tissue using CD3 epsilon antibody (86053-1-RR, Clone: 242849D3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86053-1-PBS in a different storage buffer formulation.

CD3 epsilon Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Sandwich ELISA, Indirect ELISA

Cat No. 86053-1-PBS

Clone No.242849D3

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, Sandwich ELISA, Indirect ELISA

Synonyms

CD3e, T-cell surface glycoprotein CD3 epsilon chain

---

Product Information

86053-1-PBS targets CD3 epsilon as part of a matched antibody pair:

MP02251-2: 86053-3-PBS capture and 86053-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1450

  Product name: Recombinant Rat CD3 epsilon protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 24-103 aa of NP_001101610.2

  Sequence: IEDTVTDDGAQKQYEVSISGTSVELTCPLENEDNLKWEKNDKVLPDKNEKHLVLEDFSEVKDSGYYVCYTESSRKNTYLY

• Full Name: CD3 molecule, epsilon polypeptide
• Calculated Molecular Weight: 22kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: NP_001101610.2
• Gene Symbol: Cd3e
• Gene ID (NCBI): 315609
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: A6J423
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD3 is a multimeric protein associated with the T-cell receptor (TCR) to form a complex involved in antigen recognition and signal transduction (PMID: 15885124). CD3 is composed of CD3γ, δ, ε, and ζ chains (PMID: 1826255). It is expressed by thymocytes in a developmentally regulated manner, T cells, and some NK cells (PMID: 3289580). The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction (PMID: 11985657). This antibody was raised against the epsilon chain of rat CD3 molecule.