Anti-Mouse CD30 Ligand/TNFSF8 Rabbit Recombinant Antibody

CD30 Ligand/TNFSF8 Uni-rAb® Recombinant Antibody for FC
Cat No. 98113-1-RR
Clone No.241012G10

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Tnfsf8, 241012G10, CD30 ligand, CD30-L, Tumor necrosis factor ligand superfamily member 8

Formulation:  PBS, Azide
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inAnti-CD3/CD28 treated mouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98113-1-RR targets CD30 Ligand/TNFSF8 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0667

Product name: Recombinant Mouse CD30 Ligand/TNFSF8 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: N-6*His

Domain: 68-239 aa of NM_009403.3

Sequence: QKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD

Predict reactive species
Full Name tumor necrosis factor (ligand) superfamily, member 8
Calculated Molecular Weight27 kDa
GenBank Accession NumberNM_009403.3
Gene Symbol Tnfsf8
Gene ID (NCBI) 21949
RRIDAB_3672260
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP32972
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2 - 8°C. Stable for one year after shipment.

Background Information

CD30 Ligand (CD30L), also named as TNFSF8 or CD153, is a type II transmembrane protein that belongs to the tumor necrosis factor (TNF) superfamily (PMID: 8391931). It is expressed on the surface of activated T cells, B cells, monocytes, macrophages, eosinophils, neutrophils, and mast cells (PMID: 26090498). CD30L interacts with its receptor, CD30, which is a cell surface protein expressed on a small subset of activated T and B lymphocytes, and a variety of lymphoid neoplasms, with the highest expression in classical Hodgkin lymphoma and anaplastic large cell lymphomas (PMID: 28885612). The CD30/CD30L signaling is involved in pleiotropic downstream effects including differentiation, cell survival and death, NFkB activation, and production of cytokines (PMID: 38534788).

Protocols

Product Specific Protocols
FC protocol for CD30 Ligand/TNFSF8 antibody 98113-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...