FITC Plus Anti-Mouse CD30 Ligand/TNFSF8 Rabbit Recombinant Antibody

CD30 Ligand/TNFSF8 Uni-rAb® Recombinant Antibody for FC
Cat No. FITC-98113
Clone No.241012G10

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Tnfsf8, 241012G10, CD30 ligand, CD30-L, Tumor necrosis factor ligand superfamily member 8

Formulation:  PBS, Azide
PBS, Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inanti-CD3/CD28 treated mouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98113 targets CD30 Ligand/TNFSF8 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0667

Product name: Recombinant Mouse CD30 Ligand/TNFSF8 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: N-6*His

Domain: 68-239 aa of NM_009403.3

Sequence: QKKDSTPNTTEKAPLKGGNCSEDLFCTLKSTPSKKSWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD

Predict reactive species
Full Name tumor necrosis factor (ligand) superfamily, member 8
Calculated Molecular Weight27 kDa
GenBank Accession NumberNM_009403.3
Gene Symbol Tnfsf8
Gene ID (NCBI) 21949
Conjugate FITC Plus Fluorescent Dye
Excitation/Emission Maxima Wavelengths495 nm / 524 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP32972
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD30 Ligand (CD30L), also named as TNFSF8 or CD153, is a type II transmembrane protein that belongs to the tumor necrosis factor (TNF) superfamily (PMID: 8391931). It is expressed on the surface of activated T cells, B cells, monocytes, macrophages, eosinophils, neutrophils, and mast cells (PMID: 26090498). CD30L interacts with its receptor, CD30, which is a cell surface protein expressed on a small subset of activated T and B lymphocytes, and a variety of lymphoid neoplasms, with the highest expression in classical Hodgkin lymphoma and anaplastic large cell lymphomas (PMID: 28885612). The CD30/CD30L signaling is involved in pleiotropic downstream effects including differentiation, cell survival and death, NFkB activation, and production of cytokines (PMID: 38534788).

Protocols

Product Specific Protocols
FC protocol for FITC Plus CD30 Ligand/TNFSF8 antibody FITC-98113Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...