CD300LG Polyclonal antibody

• 

  WB analysis of human kidney using 15426-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 15426-1-AP (CD300LG antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 15426-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15426-1-AP (CD300LG antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 15426-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HEK-293 cells using 15426-1-AP (CD300LG antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

CD300LG Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 15426-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

CMRF35 like molecule 9, CLM-9, CLM9, CLM 9, CD300g

---

Tested Applications

• Positive WB detected in: human kidney tissue, HepG2 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15426-1-AP targets CD300LG in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8075

  Product name: Recombinant human CD300LG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-332 aa of BC025395

  Sequence: EISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPGPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLTSPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLNSTSAEDTSPALSSGSSKPRVSIPMVRILAPVLVLLSLLSAAGLIAFCSHLLLWRKEAQQATETQRNEKFCLSRLTAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA

• Full Name: CD300 molecule-like family member g
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC025395
• Gene Symbol: CD300LG
• Gene ID (NCBI): 146894
• RRID: AB_2074217
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXG3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD300LG, also known as CLM9 (CMRF35-like molecule 9), is a member of the CD300 protein family. Members of this family are cell surface glycoproteins with a single IgV-like extracellular domain, and are involved in the regulation of immune response. CD300LG is a receptor which may mediate L-selectin-dependent lymphocyte rollings and may play an important role in inflammation.