Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Human CD302 Rabbit Recombinant Antibody, PBS Only (98413-1-PBS)

Anti-Human CD302 Rabbit Recombinant Antibody, PBS Only

Name: Anti-Human CD302 Rabbit Recombinant Antibody, PBS Only, 1mg
Brand: Proteintech
SKU: 98413-1-PBS-1MG

CD302 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98413-1-PBS

Clone No. 242903G5

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Synonyms

BIMLEC, C type lectin BIMLEC, CD302 antigen, CD302 molecule, CLEC13A

Formulation: PBS Only

PBS, Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC

FC experiment of human PBMCs using 98413-1-RR (same clone as 98413-1-PBS)
1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD302 Rabbit RecAb (98413-1-RR, Clone: 242903G5) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with APC Anti-Human CD14 . Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98413-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD302 Rabbit RecAb (98413-1-RR, Clone: 242903G5) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with APC Anti-Human CD14 . Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98413-1-PBS in a different storage buffer formulation.
FC experiment of human PBMCs using 98413-1-RR (same clone as 98413-1-PBS)
1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD302 Rabbit RecAb (98413-1-RR, Clone: 242903G5) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98413-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD302 Rabbit RecAb (98413-1-RR, Clone: 242903G5) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98413-1-PBS in a different storage buffer formulation.

Able AI

What's the best dilution for CD302 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

98413-1-PBS targets CD302 in FC applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg2671 Product name: Recombinant Human CD302 protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 23-168 aa of NM_014880.5 Sequence: DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRKYLSDNH Predict reactive species
Full Name	CD302 molecule
Calculated Molecular Weight	26 kDa
GenBank Accession Number	NM_014880.5
Gene Symbol	CD302
Gene ID (NCBI)	9936
RRID	AB_3746054
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q8IX05-1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CD302, also known as DCL-1 and CLEC13A, is a single-pass type I transmembrane glycoprotein that belongs to the C−type lectin family (PMID: 27316686). Human CD302 is most highly expressed in the liver, followed by the lung and spleen, and is predominantly expressed on myeloid cells, including monocytes, macrophages, granulocytes, and dendritic cells (PMID: 17947679; 41323386). It is involved in endocytosis and phagocytosis, as well as cell adhesion and migration (PMID: 17947679; 27316686).