Anti-Human CD302 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human CD302 Rabbit Recombinant Antibody (98413-1-RR)

CD302 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98413-1-RR Copied!

Clone No. 242903G5

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

BIMLEC, C type lectin BIMLEC, CD302 antigen, CD302 molecule, CLEC13A

• 

  FC experiment of human PBMCs using 98413-1-RR

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD302 Rabbit RecAb (98413-1-RR, Clone: 242903G5) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with APC Anti-Human CD14 . Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human PBMCs using 98413-1-RR

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD302 Rabbit RecAb (98413-1-RR, Clone: 242903G5) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD302 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98413-1-RR targets CD302 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2671

  Product name: Recombinant Human CD302 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 23-168 aa of NM_014880.5

  Sequence: DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKRKYLSDNH

• Full Name: CD302 molecule
• Calculated Molecular Weight: 26 kDa
• GenBank Accession Number: NM_014880.5
• Gene Symbol: CD302
• Gene ID (NCBI): 9936
• RRID: AB_3746054
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IX05-1
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CD302, also known as DCL-1 and CLEC13A, is a single-pass type I transmembrane glycoprotein that belongs to the C−type lectin family (PMID: 27316686). Human CD302 is most highly expressed in the liver, followed by the lung and spleen, and is predominantly expressed on myeloid cells, including monocytes, macrophages, granulocytes, and dendritic cells (PMID: 17947679; 41323386). It is involved in endocytosis and phagocytosis, as well as cell adhesion and migration (PMID: 17947679; 27316686).