Use Able AI chat for product recommendations
  • Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® APC-Cyanine7 Anti-Mouse CD31 Rabbit Recombinant Antibody

CD31 FcZero-rAb® Recombinant Antibody for FC

Cat No. AY7-FcA98258
Clone No.242041B5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Pecam, PECAM 1, Pecam1, PECAM-1

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

AY7-FcA98258 targets CD31 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0846

Product name: Recombinant Mouse CD31/PECAM-1 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 18-590 aa of NM_001305157.1

Sequence: EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKK

Predict reactive species
Full Name platelet/endothelial cell adhesion molecule 1
Calculated Molecular Weight81 kDa
GenBank Accession NumberNM_001305157.1
Gene Symbol CD31
Gene ID (NCBI) 18613
RRIDAB_3746709
Conjugate APC-Cyanine7 Fluorescent Dye
Excitation/Emission Maxima Wavelengths650 nm / 778 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ08481-1
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD31, also known as PECAM1 (Platelet endothelial cell adhesion molecule), is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. It is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, CD31 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).

Protocols

Product Specific Protocols
FC protocol for APC-Cyanine7 CD31 antibody AY7-FcA98258Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...