FITC Plus Anti-Rat CD31 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FITC Plus Anti-Rat CD31 Rabbit Recombinant Antibody (FITC-98457)

CD31 Uni-rAb^® Recombinant Antibody for FC

Cat No. FITC-98457 Copied!

Clone No. 250372H6

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC

Synonyms

Pecam, Pecam1, PECAM-1, Platelet endothelial cell adhesion molecule

• 

  FC experiment of rat splenocytes using FITC-98457

  1x10^6 rat splenocytes were surface stained with CoraLite® Plus 647 Anti-Rat CD45RA, and 0.25 ug FITC Plus Anti-Rat CD31 Rabbit RecAb (FITC-98457, Clone:250372H6) or FITC Plus Rabbit IgG Isotype Control Recombinant Antibody (FITC-98136, Clone: 240953C9). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of rat splenocytes using FITC-98457

  1x10^6 rat splenocytes were surface stained with 0.25 ug FITC Plus Anti-Rat CD31 Rabbit RecAb (FITC-98457, Clone:250372H6) (red) or FITC Plus Rabbit IgG Isotype Control Recombinant Antibody (FITC-98136, Clone: 240953C9) (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD31 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: rat splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98457 targets CD31 in FC applications and shows reactivity with rat samples.

• Tested Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1456

  Product name: Recombinant Rat CD31/PECAM-1 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 18-589 aa of NP_113779.1

  Sequence: QENSFTINSIHMESRPSWEVSNGQKLTLQCLVDISTTSKSRPQHQVLFYKDDALVYNVSSSEHTESFVIPQSRVFHAGKYKCTVILNSKEKTTIEYQLTVNGVPMPEVTVDKKEVTEGGIVTVNCSMQEEKPPIYFKIEKVELGTKNVKLSREKTSNMNFVLIEFPIEEQDHLLVFRCQAGVLSGIKMQTSEFIRSEYVTVQEFFSTPKFQIQPPEMIIEGNQLHIKCSVQVAHLAQEFPEIIIQKDKAIVATSKQSKEAVYSVMALVEHSGHYTCKVESNRISKASSILVNITELFPRPKLELSSSRLDQGEMLDLSCSVSGAPVANFTIQKEETVLSQYQNFSKIAEERDSGLYSCTAGIGKVVKRSNLVPVQVCEMLSKPRIFHDAKFEIIKGQIIGISCQSVNGTAPITYRLLRAKSNFQTVQKNSNDPVTFTDKPTRDMEYQCIVDNCHSHPEVRSEILRVKVIAPVDEVTISILSGNDVQSGDEMVLRCSVKEGTGPVTFQFYKEKEGRPFHEETVNDTQVFWHHEQTSKEQEGQYYCTAFNRASIVTSLRSGPLTVRVFLAPWKK

• Full Name: platelet/endothelial cell adhesion molecule 1
• Calculated Molecular Weight: 76kDa
• GenBank Accession Number: NP_113779.1
• Gene Symbol: Pecam1
• Gene ID (NCBI): 29583
• Conjugate: FITC Plus Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 495 nm / 524 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q3SWT0
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD31, also known as PECAM1 (Platelet endothelial cell adhesion molecule), is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. It is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, CD31 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).