CD31 Recombinant monoclonal antibody

CD31 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, ELISA
Cat No. 85898-4-RR
Clone No.250372F8

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, ELISA

Pecam, Pecam1, PECAM-1, Platelet endothelial cell adhesion molecule

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse lung tissue, rat spleen tissue, rat lung tissue
Positive IHC detected inrat liver tissue, rat kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat liver tissue

This antibody does not react with human CD31.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85898-4-RR targets CD31 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1456

Product name: recombinant rat CD31/PECAM-1 protein

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 18-589 aa of NP_113779.1

Sequence: QENSFTINSIHMESRPSWEVSNGQKLTLQCLVDISTTSKSRPQHQVLFYKDDALVYNVSSSEHTESFVIPQSRVFHAGKYKCTVILNSKEKTTIEYQLTVNGVPMPEVTVDKKEVTEGGIVTVNCSMQEEKPPIYFKIEKVELGTKNVKLSREKTSNMNFVLIEFPIEEQDHLLVFRCQAGVLSGIKMQTSEFIRSEYVTVQEFFSTPKFQIQPPEMIIEGNQLHIKCSVQVAHLAQEFPEIIIQKDKAIVATSKQSKEAVYSVMALVEHSGHYTCKVESNRISKASSILVNITELFPRPKLELSSSRLDQGEMLDLSCSVSGAPVANFTIQKEETVLSQYQNFSKIAEERDSGLYSCTAGIGKVVKRSNLVPVQVCEMLSKPRIFHDAKFEIIKGQIIGISCQSVNGTAPITYRLLRAKSNFQTVQKNSNDPVTFTDKPTRDMEYQCIVDNCHSHPEVRSEILRVKVIAPVDEVTISILSGNDVQSGDEMVLRCSVKEGTGPVTFQFYKEKEGRPFHEETVNDTQVFWHHEQTSKEQEGQYYCTAFNRASIVTSLRSGPLTVRVFLAPWKK

Predict reactive species
Full Name platelet/endothelial cell adhesion molecule 1
Calculated Molecular Weight76kDa
Observed Molecular Weight100-130 kDa
GenBank Accession NumberNP_113779.1
Gene Symbol Pecam1
Gene ID (NCBI) 29583
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ3SWT0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).

Protocols

Product Specific Protocols
IF protocol for CD31 antibody 85898-4-RRDownload protocol
IHC protocol for CD31 antibody 85898-4-RRDownload protocol
WB protocol for CD31 antibody 85898-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...