PE Anti-Mouse CD314/NKG2D Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• PE Anti-Mouse CD314/NKG2D Rabbit Recombinant Antibody (PE-98481-2)

CD314/NKG2D Uni-rAb^® Recombinant Antibody for FC

Cat No. PE-98481-2 Copied!

Clone No. 250267G1

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD314, Klrk1, Killer cell lectin-like receptor subfamily K member 1, NK cell receptor D, NKG2 D

• 

  FC experiment of mouse splenocytes using PE-98481-2

  1x10^6 mouse splenocytes were surface stained with CoraLite® Plus 647 Anti-Mouse NK1.1, and 0.1 ug PE Anti-Mouse CD314/NKG2D Rabbit RecAb (PE-98481-2, Clone: 250267G1) or PE Rabbit IgG Isotype Control Recombinant Antibody (PE-98136, Clone: 240953C9). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD314/NKG2D in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

PE-98481-2 targets CD314/NKG2D in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3829

  Product name: Recombinant Mouse CD314/NKG2D protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 90-232 aa of NM_033078.4

  Sequence: FKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV

• Full Name: killer cell lectin-like receptor subfamily K, member 1
• Calculated Molecular Weight: 27 kDa
• GenBank Accession Number: NM_033078.4
• Gene Symbol: CD314
• Gene ID (NCBI): 27007
• Conjugate: PE Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O54709-1
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD314, also known as NKG2D or Killer cell lectin-like receptor subfamily K member 1 (KLRK1), is a type II lectin-like transmembrane stimulatory receptor (PMID: 8436421). In mice, CD314 is expressed on NK cells, activated CD8(+) T cells and macrophages, and subsets of TCR gamma delta (+) and NK1.1 (+) T cells (PMID: 12150888). Various subfamilies of MHC class I-related glycoproteins have been identified as the ligands for mouse CD314, including RAET1A, RAET1B, RAET1C, RAET1D, RAET1E, H60 and MULT1 (PMID: 31720075).