CD320 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CD320 Polyclonal antibody, PBS Only (10343-1-PBS)

• 

  WB analysis using 10343-1-AP (same clone as 10343-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10343-1-AP (CD320 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10343-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 10343-1-AP (same clone as 10343-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10343-1-AP (CD320 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10343-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 10343-1-AP (same clone as 10343-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10343-1-AP (CD320 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10343-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CD320 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10343-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

8D6, 8D6A, FDC-signaling molecule 8D6, FDC-SM-8D6, TCblR

---

Product Information

10343-1-PBS targets CD320 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0344

  Product name: Recombinant human CD320 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 84-280 aa of BC000668

  Sequence: SDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTS

• Full Name: CD320 molecule
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 60-70 kDa, 35-40 kDa
• GenBank Accession Number: BC000668
• Gene Symbol: CD320
• Gene ID (NCBI): 51293
• RRID: AB_2074223
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NPF0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD320, also known as 8D6, 8D6A or TCblR, is a single-pass type I membrane protein containing 2 LDL-receptor class A domains. Expressed abundantly on follicular dendritic cells (FDCs), CD320 has been shown to enhance proliferation of germinal center (GC) B cells. It is the receptor for cellular uptake of transcobalamin-bound cobalamin. Defects in CD320 are the cause of methylmalonic aciduria type TCblR (MMATC). CD320 has a calculated molecular mass of 29 kDa. This antibody raised against 84-280aa of human CD320 protein detects bands at 35-40 kDa and 60-70 kDa. The aberrant mobility of the protein by SDS-PAGE is probably caused by extensive complex glycosylation (PMID: 18779389; 23415653).