CD320 Recombinant monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CD320 Recombinant monoclonal antibody, PBS Only (Detector) (83574-7-PBS)

CD320 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 83574-7-PBS

Clone No.242900F5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

• 

  Sandwich ELISA sample test of MP00564-4

  Serum of sixteen individual healthy human donors was measured. The CD320 concentration of detected samples was determined to be 1.95 ng/mL with a range of 0.51-4.41 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP00564-4

  Sandwich ELISA standard curve of MP00564-4, Human CD320 Recombinant Matched Antibody Pair - PBS only. 83574-8-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg2795. 83574-7-PBS was HRP conjugated as the detection antibody. Range: 0.781-50 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

83574-7-PBS targets CD320 as part of a matched antibody pair:

MP00564-4: 83574-8-PBS capture and 83574-7-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2795

  Product name: Recombinant Human CD320 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 36-229 aa of NM_016579.3

  Sequence: SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAY

• Full Name: CD320 molecule
• Calculated Molecular Weight: 29 kDa
• GenBank Accession Number: NM_016579.3
• Gene Symbol: CD320
• Gene ID (NCBI): 51293
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NPF0-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD320, also known as 8D6, 8D6A or TCblR, is a single-pass type I membrane protein containing 2 LDL-receptor class A domains. Expressed abundantly on follicular dendritic cells (FDCs), CD320 has been shown to enhance proliferation of germinal center (GC) B cells. It is the receptor for cellular uptake of transcobalamin-bound cobalamin. Defects in CD320 are the cause of methylmalonic aciduria type TCblR (MMATC). CD320 has a calculated molecular mass of 29 kDa.The apparent molecular weight detected by this antibody is 70 kDa. The aberrant mobility of the protein by SDS-PAGE is probably caused by extensive complex glycosylation (PMID: 18779389; 23415653).