FcZero-rAb® APC Anti-Human CD33 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® APC Anti-Human CD33 Rabbit Recombinant Antibody (APC-FcA98184)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

CD33 FcZero-rAb^® Recombinant Antibody for FC

Cat No. APC-FcA98184

Clone No.241711C12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD33 molecule, gp67, p67, Sialic acid-binding Ig-like lectin 3, SIGLEC 3

• 

  FC experiment of human PBMCs using APC-FcA98184

  1x10^6 human PBMCs were surface stained with PE Anti-Human CD14, and 5 ul APC Anti-Human CD33 Rabbit RecAb (APC-FcA98184, Clone: 241711C12) or APC Rabbit IgG Isotype Control RecAb (APC-FcA98136, Clone: 240953C9). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98184 targets CD33 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2138

  Product name: Recombinant Human CD33 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 18-259 aa of BC028152

  Sequence: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

• Full Name: CD33 molecule
• Calculated Molecular Weight: 364 aa, 40 kDa
• GenBank Accession Number: BC028152
• Gene Symbol: CD33
• Gene ID (NCBI): 945
• RRID: AB_3746583
• Conjugate: APC Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P20138
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD33, also referred to as Siglec-3, is a 67-kDa glycosylated transmembrane protein of sialic acid-binding immunoglobulin-like lactic (siglec) family. CD33 is expressed on monocytes, myeloid progenitors, granulocytes, mast cells, some T cells. It may mediate cell-to-cell adhesion and act as a receptor that inhibits the proliferation of normal and leukemic myeloid cells.