CoraLite® Plus 405 Anti-Human CD33 Rabbit Recombinant Antibody

• 

  FC experiment of human PBMCs using CL405-98184

  1x10^6 human PBMCs were surface stained with APC Anti-Human CD14, and 5 ul CoraLite® Plus 405 Anti-Human CD33 Rabbit RecAb (CL405-98184, Clone: 241711C12) or CoraLite® Plus 405 Rabbit IgG Isotype Control Recombinant Antibody (CL405-98136, Clone: 240953C9). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of human PBMCs using CL405-98184

  1x10^6 human PBMCs were surface stained with 5 ul CoraLite® Plus 405 Anti-Human CD33 Rabbit RecAb (CL405-98184, Clone: 241711C12) (red) or CoraLite® Plus 405 Rabbit IgG Isotype Control Recombinant Antibody (CL405-98136, Clone: 240953C9) (blue). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

CD33 Uni-rAb^® Recombinant Antibody for FC

Cat No. CL405-98184

Clone No.241711C12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

241711C12, CD33 molecule, gp67, p67, Sialic acid-binding Ig-like lectin 3

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

CL405-98184 targets CD33 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2138

  Product name: Recombinant Human CD33 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 18-259 aa of BC028152

  Sequence: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

• Full Name: CD33 molecule
• Calculated Molecular Weight: 364 aa, 40 kDa
• GenBank Accession Number: BC028152
• Gene Symbol: CD33
• Gene ID (NCBI): 945
• Conjugate: CoraLite® Plus 405 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 399 nm / 422 nm
• Excitation Laser: Violet Laser (405 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P20138
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD33, also referred to as Siglec-3, is a 67-kDa glycosylated transmembrane protein of sialic acid-binding immunoglobulin-like lactic (siglec) family. CD33 is expressed on monocytes, myeloid progenitors, granulocytes, mast cells, some T cells. It may mediate cell-to-cell adhesion and act as a receptor that inhibits the proliferation of normal and leukemic myeloid cells.