CoraLite® Plus 647-conjugated CD33 Recombinant monoclonal antibody

• 

  IF Staining of THP-1 using CL647-84341-3

  Immunofluorescent analysis of (-20°C Methanol) fixed THP-1 cells using CoraLite® Plus 647 CD33 antibody (CL647-84341-3, Clone: 241711D2 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

CD33 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL647-84341-3

Clone No.241711D2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

CD33 molecule, gp67, p67, Sialic acid-binding Ig-like lectin 3, SIGLEC 3

---

Tested Applications

• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-84341-3 targets CD33 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2138

  Product name: Recombinant Human CD33 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 18-259 aa of BC028152

  Sequence: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

• Full Name: CD33 molecule
• Calculated Molecular Weight: 364 aa, 40 kDa
• Observed Molecular Weight: 55-75 kDa
• GenBank Accession Number: BC028152
• Gene Symbol: CD33
• Gene ID (NCBI): 945
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P20138
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CD33, also referred to as Siglec-3, is a 67-kDa glycosylated transmembrane protein of sialic acid-binding immunoglobulin-like lactic (siglec) family. CD33 is expressed on monocytes, myeloid progenitors, granulocytes, mast cells, some T cells. It may mediate cell-to-cell adhesion and act as a receptor that inhibits the proliferation of normal and leukemic myeloid cells.