CoraLite®594 Anti-Human CD36 Rabbit Recombinant Antibody

CD36 Uni-rAb® Recombinant Antibody for FC

Cat No. CL594-98132
Clone No.241262D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

241262D5, Glycoprotein IIIb, GP3B, GP4, GPIIIB

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-98132 targets CD36 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1070

Product name: Recombinant Human CD36/SR-B3 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 30-439 aa of NM_001001548.3

Sequence: GDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKIN

Predict reactive species
Full Name CD36 molecule (thrombospondin receptor)
Calculated Molecular Weight53 kDa
GenBank Accession NumberNM_001001548.3
Gene Symbol CD36
Gene ID (NCBI) 948
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP16671-1
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Function

CD36, also known as platelet glycoprotein 4, is an integral membrane glycoprotein that acts as a scavenger receptor. CD36 can bind to multiple ligands, including thrombospondin-1, collagen, oxidized phospholipids, oxidized low-density lipoprotein, and long-chain fatty acids. CD36 can also bind to erythrocytes parasitized by Plasmodium falciparum and apoptotic cells. CD36 mediates different biological processes, acting as a signaling hub in angiogenesis, inflammatory response, and fatty acid metabolism.

Tissue specificity

CD36 is present on the surface of various cells types, such as adipocytes, monocytes, macrophages, platelets, microvascular endothelial cells, dendritic cells, and hematopoietic precursors of red cells.

Involvement in disease
  • Mutations in CD36 can give rise to platelet glycoprotein IV deficiency, a type of macrothrombocytopenia.

  • Polymorphisms in CD36 can increase susceptibility to malaria.

  • AAGIC haplotype at the CD36 locus increases the risk of coronary heart disease.

  • Disruption of CD36-dependent pathways and certain SNPs in the CD36 gene are attributed to impaired fatty acid metabolism, glucose intolerance, Alzheimer's disease, atherosclerosis, arterial hypertension, diabetes, and cardiomyopathy.

Isoforms

Apart from the full-length protein (isoform 1), one additional shorter isoform has been reported (PMID: 7509795). Other alternative isoforms have also been detected on the mRNA level (PMID: 17673938).

Post-translational modifications

The extracellular domain of CD36 is extensively glycosylated. Glycosylation is needed for the transport of CD36 to the plasma membrane, as well as mediating recognition and binding to ligands. Cytoplasmic tails of transmembrane domains can be phosphorylated and play a role in signal transduction. Intracellular domains can be additionally acetylated, ubiquitinated, and palmitoylated (PMID: 28919632).

Cellular localization

CD36 is present on the cell surface.

Protocols

Product Specific Protocols
FC protocol for CL594 CD36 antibody CL594-98132Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...