CD3EAP Recombinant monoclonal antibody, PBS Only (Capture)

CD3EAP Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 84139-4-PBS
Clone No.241379H5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

241379H5, A34.5, Antisense to ERCC-1 protein, ASE1, ASE-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84139-4-PBS targets CD3EAP as part of a matched antibody pair:

MP01056-3: 84139-4-PBS capture and 84139-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35074

Product name: Recombinant human CD3EAP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-130 aa of BC038992

Sequence: MEEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEGPQQSLSGSPL

Predict reactive species
Full Name CD3e molecule, epsilon associated protein
Calculated Molecular Weight 510 aa, 55 kDa
Observed Molecular Weight80-90 kDa
GenBank Accession NumberBC038992
Gene Symbol CD3EAP
Gene ID (NCBI) 10849
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15446
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Human RNA polymerase I (Pol I)-specific subunit, previously identified as ASE-1 and as CD3ɛ-associated signal transducer (CAST), CD3EAP is a 55 kDa nucleolar autoantigen that has an apparent molecular mass of 90 kDa (PMID: 11199923). CD3EAP/hPAF49 contains a single tyrosine residue at position 82 (Tyr82), which is phosphorylated upon stimulation of the T-cell receptor. Western blot analysis detected CD3EAP at an apparent molecular mass of ~80-90 kDa.

Loading...
||
New chat Able
正在加载,请稍候...